CABS-dock: e6eaa892ba2879

Project name: e6eaa892ba2879

Status: done

submitted: 2026-03-09 05:02:41, status changed: 2026-03-09 07:34:03

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGSNPA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.5677	5.77996	24.9611	142
cluster_2.pdb ( medoid)	23.6815	5.57397	26.159	132
cluster_3.pdb ( medoid)	16.0235	7.48901	36.1444	120
cluster_4.pdb ( medoid)	11.2585	10.0369	36.2206	113
cluster_5.pdb ( medoid)	10.3814	10.4032	32.292	108
cluster_6.pdb ( medoid)	7.57724	11.3498	27.2639	86
cluster_7.pdb ( medoid)	7.48501	12.692	28.9251	95
cluster_8.pdb ( medoid)	6.75789	11.838	35.887	80
cluster_9.pdb ( medoid)	6.46743	8.96802	17.9125	58
cluster_10.pdb ( medoid)	4.5315	14.5647	34.6534	66