CABS-dock: e770e6abe770bb8

Project name: e770e6abe770bb8

Status: done

submitted: 2026-03-18 05:37:01, status changed: 2026-03-18 20:58:48

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RRRRVQLFGDNAYRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.1732	5.21239	28.4076	126
cluster_2.pdb ( medoid)	21.1927	5.19046	27.0494	110
cluster_3.pdb ( medoid)	17.3109	6.1233	26.8213	106
cluster_4.pdb ( medoid)	16.9914	7.59206	38.1912	129
cluster_5.pdb ( medoid)	12.8368	9.19234	27.6925	118
cluster_6.pdb ( medoid)	11.3325	8.82419	22.0697	100
cluster_7.pdb ( medoid)	9.28878	13.0265	47.2751	121
cluster_8.pdb ( medoid)	8.97313	12.4817	43.516	112
cluster_9.pdb ( medoid)	2.28219	23.6615	48.2276	54
cluster_10.pdb ( medoid)	1.98908	12.0659	33.8349	24