CABS-dock: 1104

Project name: 1104

Status: done

submitted: 2026-04-20 16:39:21, status changed: 2026-04-20 22:58:45

Project settings

Protein sequence(s)	MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence	SDFRRQNRRGGTKRSST
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHCHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.2483	3.09791	35.0598	103
cluster_2.pdb ( medoid)	12.1955	8.03572	16.8655	98
cluster_3.pdb ( medoid)	11.0216	7.98432	20.0487	88
cluster_4.pdb ( medoid)	10.6505	8.07473	34.8677	86
cluster_5.pdb ( medoid)	8.95952	8.59422	21.9012	77
cluster_6.pdb ( medoid)	8.56478	11.3255	23.5107	97
cluster_7.pdb ( medoid)	7.80157	13.587	43.3145	106
cluster_8.pdb ( medoid)	7.08198	11.0139	31.6107	78
cluster_9.pdb ( medoid)	4.09262	11.2397	22.4428	46
cluster_10.pdb ( medoid)	2.36993	8.86104	19.8531	21