CABS-dock: primed p17

Project name: primed p17

Status: done

submitted: 2025-05-09 14:43:30, status changed: 2025-05-09 19:45:08

Project settings

Protein sequence(s)	TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence	QWKFEY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.8362	4.20232	25.0711	159
cluster_2.pdb ( medoid)	23.6047	6.26994	32.7227	148
cluster_3.pdb ( medoid)	21.2311	7.67743	41.189	163
cluster_4.pdb ( medoid)	17.7862	6.2408	24.5768	111
cluster_5.pdb ( medoid)	14.8199	8.16471	33.303	121
cluster_6.pdb ( medoid)	9.86737	8.91828	28.7048	88
cluster_7.pdb ( medoid)	8.24148	8.00827	24.9394	66
cluster_8.pdb ( medoid)	8.18307	7.57662	21.5757	62
cluster_9.pdb ( medoid)	5.56572	9.70225	25.2352	54
cluster_10.pdb ( medoid)	2.4726	11.3241	36.895	28