Project name: e7d46d13087480c

Status: done

submitted: 2026-01-21 10:49:40, status changed: 2026-01-21 13:24:32

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence VVVVVVVVVVVV
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.1207 2.45216 14.5017 118
cluster_2.pdb ( medoid) 41.6273 2.57043 13.9692 107
cluster_3.pdb ( medoid) 40.6974 5.16003 15.6524 210
cluster_4.pdb ( medoid) 19.2773 4.20183 11.891 81
cluster_5.pdb ( medoid) 18.5539 4.68904 22.6469 87
cluster_6.pdb ( medoid) 10.4657 10.9883 25.9509 115
cluster_7.pdb ( medoid) 9.91148 10.392 25.6095 103
cluster_8.pdb ( medoid) 7.73175 12.0283 30.0529 93
cluster_9.pdb ( medoid) 6.30677 9.83071 19.6583 62
cluster_10.pdb ( medoid) 4.2742 5.61509 11.0302 24