Project name: e852935fe4eec06

Status: done

submitted: 2026-07-23 10:36:37, status changed: 2026-07-23 12:30:06

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RRVIVVQCGFSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.0717 6.57642 38.6673 132
cluster_2.pdb ( medoid) 13.6522 9.81526 36.6766 134
cluster_3.pdb ( medoid) 12.0437 13.2019 38.6701 159
cluster_4.pdb ( medoid) 8.16263 10.2908 37.7737 84
cluster_5.pdb ( medoid) 8.00739 14.7364 53.3252 118
cluster_6.pdb ( medoid) 7.46536 9.91245 30.7742 74
cluster_7.pdb ( medoid) 6.50768 15.5201 37.4954 101
cluster_8.pdb ( medoid) 4.2341 21.256 52.0078 90
cluster_9.pdb ( medoid) 3.45151 14.1967 35.545 49
cluster_10.pdb ( medoid) 2.97011 19.8646 47.8701 59