CABS-dock: LHO_Neg_EB

Project name: LHO_Neg_EB_A35R

Status: done

submitted: 2025-11-26 05:56:39, status changed: 2025-11-26 09:24:22

Project settings

Protein sequence(s)

MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRQNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCT input pdb

Peptide sequence

LAAAVAPLLRPLKKRALLAV

Simulation mc cycles

Peptide secondary structure psipred

CHHHHHHHHHHHHHHHHHCC

Unlikely to bind regions

181:A - 58:A

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.9507	5.14146	22.8944	118
cluster_2.pdb ( medoid)	15.4071	8.50255	17.752	131
cluster_3.pdb ( medoid)	13.3632	9.9527	30.7276	133
cluster_4.pdb ( medoid)	12.2059	11.6337	32.7571	142
cluster_5.pdb ( medoid)	11.1069	12.0646	43.6943	134
cluster_6.pdb ( medoid)	9.76945	8.59823	24.055	84
cluster_7.pdb ( medoid)	4.33959	11.5218	21.6964	50
cluster_8.pdb ( medoid)	3.44036	12.208	22.9129	42
cluster_9.pdb ( medoid)	3.35916	13.3962	30.7076	45
cluster_10.pdb ( medoid)	1.53908	13.6445	22.4945	21