Project name: 7NUI_EMGFKH_E2

Status: done

submitted: 2026-05-30 15:59:59, status changed: 2026-05-31 15:57:13

Project settings
Protein sequence(s) GSHSMRYFDTAMSRPGRGEPRFISSVGYVDDTQFVRFDSDAASPRMEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence EMGFKHINHQVVPTLAVSKNKAL
Simulation mc cycles200
Peptide secondary structure psipred CCCCCCCCCCCCCEEEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 76.0512 1.32805 6.46286 101
cluster_2.pdb ( medoid) 45.6352 2.16938 3.94064 99
cluster_3.pdb ( medoid) 25.0797 3.6683 11.4933 92
cluster_4.pdb ( medoid) 19.9778 5.20577 18.6403 104
cluster_5.pdb ( medoid) 17.9799 7.78647 19.1721 140
cluster_6.pdb ( medoid) 10.9971 12.6397 26.3166 139
cluster_7.pdb ( medoid) 9.91954 5.94785 16.379 59
cluster_8.pdb ( medoid) 8.09719 14.4495 30.9353 117
cluster_9.pdb ( medoid) 7.65078 13.9855 35.6823 107
cluster_10.pdb ( medoid) 5.22103 8.04439 17.0228 42