CABS-dock: 8TBP_CEEASV

Project name: 8TBP_CEEASV_E2

Status: done

submitted: 2026-05-30 16:17:43, status changed: 2026-05-31 08:37:19

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	CEEASVTVVEGQVDYYGLYYVHEGIR
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCEEEEEEEEEEEEEEEEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.1038	8.05542	30.1487	170
cluster_2.pdb ( medoid)	18.6303	6.22642	46.3353	116
cluster_3.pdb ( medoid)	17.3368	10.0364	35.5372	174
cluster_4.pdb ( medoid)	10.0374	11.7561	44.5779	118
cluster_5.pdb ( medoid)	8.24331	13.1015	59.6439	108
cluster_6.pdb ( medoid)	5.99608	18.3453	49.3444	110
cluster_7.pdb ( medoid)	3.67924	16.3077	43.883	60
cluster_8.pdb ( medoid)	2.61992	19.0846	51.1866	50
cluster_9.pdb ( medoid)	2.50184	25.9809	53.2568	65
cluster_10.pdb ( medoid)	1.68927	16.5752	33.8311	28