Project name: e97fab0fa953f1d

Status: done

submitted: 2026-06-13 16:29:54, status changed: 2026-06-13 21:34:37

Project settings
Protein sequence(s) QRHVRIGIIGGGPAGLTAGIYASRANLKTCVFVGIEHTSQMFTTTDVENFPSHTAIKGPALMEAIQNQAEHCGAELLYEDVHSIDVSSRPFKIVHGYENETTLADALIIATGATARRLDCKGEKEYWQKGVSACAVCDSAMATGKEVVVVGGGDVACEEATYLTKIATKVYMVLRRDKFRASAAMVKKVMNEKLIEIIYDSAIDEIKGDGKCVTSVSIKNLKDGKTRTLNAGALYWAVGHDPQTSFLKKGQLEQDEAGYILLKDHPTQRTSVDGVFAAGDCCDHLYRQAVVAAGSGSKAALDAERWLAM input pdb
Peptide sequence RRWWFR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.8453 2.88503 29.7127 164
cluster_2.pdb ( medoid) 46.8272 3.60901 12.1779 169
cluster_3.pdb ( medoid) 28.4074 4.64668 35.6313 132
cluster_4.pdb ( medoid) 24.2234 8.09134 30.8073 196
cluster_5.pdb ( medoid) 17.4275 7.63163 17.5508 133
cluster_6.pdb ( medoid) 13.8374 4.55289 9.81493 63
cluster_7.pdb ( medoid) 7.79233 2.56663 11.0012 20
cluster_8.pdb ( medoid) 7.69963 4.67555 11.251 36
cluster_9.pdb ( medoid) 7.24205 5.10905 10.9886 37
cluster_10.pdb ( medoid) 3.67622 13.6009 29.3292 50