Project name: docking 2ai8 p1

Status: done

submitted: 2025-12-23 01:58:38, status changed: 2025-12-23 06:04:31

Project settings
Protein sequence(s) SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKA input pdb
Peptide sequence NMAIHPR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.8398 4.61168 24.1474 133
cluster_2.pdb ( medoid) 28.3546 3.87945 13.8658 110
cluster_3.pdb ( medoid) 26.576 6.73541 45.5635 179
cluster_4.pdb ( medoid) 19.6451 4.88671 18.2475 96
cluster_5.pdb ( medoid) 16.625 11.2481 39.3586 187
cluster_6.pdb ( medoid) 15.1926 3.29108 19.1022 50
cluster_7.pdb ( medoid) 9.11259 7.68168 24.6341 70
cluster_8.pdb ( medoid) 6.87044 11.353 35.9784 78
cluster_9.pdb ( medoid) 3.36706 14.5528 34.9988 49
cluster_10.pdb ( medoid) 3.0852 15.5581 40.0958 48