Project name: 260628_LepB_3Y_1

Status: done

submitted: 2026-06-28 04:12:06, status changed: 2026-06-28 08:19:07

Project settings
Protein sequence(s) RSFIYEPFQIPSGSMMPTLLIGDFILVEKFAYGIKDPIYQKTLIETGHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSSGQACENALPVTYSNVEPSDFVQTFSRRNGGEATSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDGLRLSRIGGIH input pdb
Peptide sequence MLSFAADYYY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.4208 3.75436 21.8806 148
cluster_2.pdb ( medoid) 21.398 10.0944 45.0908 216
cluster_3.pdb ( medoid) 17.6743 5.88424 24.8379 104
cluster_4.pdb ( medoid) 16.2841 3.80739 16.2255 62
cluster_5.pdb ( medoid) 12.132 4.2862 18.8125 52
cluster_6.pdb ( medoid) 11.4804 8.88471 23.6473 102
cluster_7.pdb ( medoid) 8.78711 9.78706 33.4915 86
cluster_8.pdb ( medoid) 6.09868 14.7573 41.1214 90
cluster_9.pdb ( medoid) 5.00664 13.582 40.4039 68
cluster_10.pdb ( medoid) 3.87668 18.5726 47.3451 72