CABS-dock: e9ee91bf0ed7063

Project name: e9ee91bf0ed7063

Status: done

submitted: 2026-07-08 15:40:56, status changed: 2026-07-08 19:55:15

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQPYGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.1781	5.90233	47.1592	125
cluster_2.pdb ( medoid)	12.3113	10.8031	41.1693	133
cluster_3.pdb ( medoid)	10.694	11.9693	58.9503	128
cluster_4.pdb ( medoid)	9.95365	10.0466	30.0436	100
cluster_5.pdb ( medoid)	7.54447	15.7732	49.1349	119
cluster_6.pdb ( medoid)	6.35161	16.3738	51.2204	104
cluster_7.pdb ( medoid)	5.05496	15.826	49.2944	80
cluster_8.pdb ( medoid)	4.52225	18.7959	61.849	85
cluster_9.pdb ( medoid)	4.31793	19.2222	58.1044	83
cluster_10.pdb ( medoid)	1.53082	28.0896	69.3451	43