CABS-dock: eac7ea10e667403

Project name: eac7ea10e667403

Status: done

submitted: 2026-03-16 05:43:22, status changed: 2026-03-16 10:40:45

Project settings

Protein sequence(s)	MNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYP input pdb
Peptide sequence	ALSLALVTNS
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	70.9604	3.509	32.971	249
cluster_2.pdb ( medoid)	49.7147	4.32468	31.2355	215
cluster_3.pdb ( medoid)	14.2681	5.67699	10.4711	81
cluster_4.pdb ( medoid)	11.8865	7.7399	24.2944	92
cluster_5.pdb ( medoid)	11.6857	5.64793	14.2508	66
cluster_6.pdb ( medoid)	10.8217	8.1318	23.0347	88
cluster_7.pdb ( medoid)	9.90305	6.76559	23.231	67
cluster_8.pdb ( medoid)	8.73274	6.52716	30.6657	57
cluster_9.pdb ( medoid)	7.36149	7.06379	16.8061	52
cluster_10.pdb ( medoid)	2.92232	11.2924	26.2077	33