Project name: eac7ea10e667403

Status: done

submitted: 2026-03-16 05:43:22, status changed: 2026-03-16 10:40:45

Project settings
Protein sequence(s) MNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYP input pdb
Peptide sequence ALSLALVTNS
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 70.9604 3.509 32.971 249
cluster_2.pdb ( medoid) 49.7147 4.32468 31.2355 215
cluster_3.pdb ( medoid) 14.2681 5.67699 10.4711 81
cluster_4.pdb ( medoid) 11.8865 7.7399 24.2944 92
cluster_5.pdb ( medoid) 11.6857 5.64793 14.2508 66
cluster_6.pdb ( medoid) 10.8217 8.1318 23.0347 88
cluster_7.pdb ( medoid) 9.90305 6.76559 23.231 67
cluster_8.pdb ( medoid) 8.73274 6.52716 30.6657 57
cluster_9.pdb ( medoid) 7.36149 7.06379 16.8061 52
cluster_10.pdb ( medoid) 2.92232 11.2924 26.2077 33