CABS-dock: eb6f30865a371a

Project name: eb6f30865a371a

Status: done

submitted: 2026-03-09 08:46:47, status changed: 2026-03-09 14:39:53

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQLFGDNAY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.234	5.71905	29.4219	110
cluster_2.pdb ( medoid)	18.3256	7.85788	37.2467	144
cluster_3.pdb ( medoid)	18.0002	4.88884	19.965	88
cluster_4.pdb ( medoid)	12.6744	8.67892	26.031	110
cluster_5.pdb ( medoid)	10.0026	10.7972	26.2588	108
cluster_6.pdb ( medoid)	9.42801	9.97029	27.1083	94
cluster_7.pdb ( medoid)	8.03904	12.5637	25.4108	101
cluster_8.pdb ( medoid)	7.81436	14.0766	36.0166	110
cluster_9.pdb ( medoid)	7.14499	11.4766	26.5893	82
cluster_10.pdb ( medoid)	2.91174	18.2022	50.8923	53