Project name: eb6f30865a371a

Status: done

submitted: 2026-03-09 08:46:47, status changed: 2026-03-09 14:39:53

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQLFGDNAY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.234 5.71905 29.4219 110
cluster_2.pdb ( medoid) 18.3256 7.85788 37.2467 144
cluster_3.pdb ( medoid) 18.0002 4.88884 19.965 88
cluster_4.pdb ( medoid) 12.6744 8.67892 26.031 110
cluster_5.pdb ( medoid) 10.0026 10.7972 26.2588 108
cluster_6.pdb ( medoid) 9.42801 9.97029 27.1083 94
cluster_7.pdb ( medoid) 8.03904 12.5637 25.4108 101
cluster_8.pdb ( medoid) 7.81436 14.0766 36.0166 110
cluster_9.pdb ( medoid) 7.14499 11.4766 26.5893 82
cluster_10.pdb ( medoid) 2.91174 18.2022 50.8923 53