CABS-dock: EP4 CMH1

Project name: EP4 CMH1

Status: done

submitted: 2025-11-25 10:54:05, status changed: 2025-11-25 17:26:10

Project settings

Protein sequence(s)	GSHSMRYFYTSMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQRMYGCDVGPDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCHVQHEGLPKPLTLKW input pdb
Peptide sequence	SAYAANAGV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	64.8057	3.81139	23.6588	247
cluster_2.pdb ( medoid)	48.8671	1.96451	6.3423	96
cluster_3.pdb ( medoid)	33.635	3.62718	25.0283	122
cluster_4.pdb ( medoid)	22.6496	4.85659	13.9397	110
cluster_5.pdb ( medoid)	14.0341	5.41538	26.6607	76
cluster_6.pdb ( medoid)	9.08563	14.7486	46.1267	134
cluster_7.pdb ( medoid)	8.19851	4.87893	8.81652	40
cluster_8.pdb ( medoid)	6.94279	9.36223	42.657	65
cluster_9.pdb ( medoid)	3.91016	9.71826	21.7093	38
cluster_10.pdb ( medoid)	3.02758	17.5057	43.1873	53