Project name: JG36787.T1+P04295

Status: done

submitted: 2026-02-27 10:30:21, status changed: 2026-02-27 17:55:21

Project settings
Protein sequence(s) PVLTKSAGERFLLYRPSTTTNSGLMAPDLYVYVDPAFTANTRASGTGVAVVGRYRDDYIIFALEHFFLRALTGSAPADIARCVVHSLTQVLALHPGAFRGVRVAVEGNSSQDSAVAIATHVHTEMHRLLASEGADAGSGPELLFYHCEPPGSAVLYPFFLLNKQKTPAFEHFIKKFNSGGVMASQEIVSATVRLQTDPVEYLLEQLNNLTETVSPNTDGASDDLMVAVIMAIYLAAQAGPPHTF input pdb
Peptide sequence KVKRITPRHLQLA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.9796 5.96747 20.3415 161
cluster_2.pdb ( medoid) 24.7481 5.13171 24.9179 127
cluster_3.pdb ( medoid) 15.6896 5.22638 12.7307 82
cluster_4.pdb ( medoid) 11.5526 10.9067 25.0671 126
cluster_5.pdb ( medoid) 10.9928 8.09621 27.0878 89
cluster_6.pdb ( medoid) 9.06645 6.17662 18.8549 56
cluster_7.pdb ( medoid) 8.7236 8.13885 17.241 71
cluster_8.pdb ( medoid) 8.61923 16.5908 42.9756 143
cluster_9.pdb ( medoid) 6.97264 13.9115 37.1921 97
cluster_10.pdb ( medoid) 6.7475 7.11374 16.2539 48