CABS-dock: ebe8c3217ff9b50

Project name: ebe8c3217ff9b50

Status: done

submitted: 2026-03-09 15:20:04, status changed: 2026-03-09 17:55:28

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	69.0191	1.49234	19.8168	103
cluster_2.pdb ( medoid)	26.2173	3.85242	18.8775	101
cluster_3.pdb ( medoid)	15.7067	7.13072	21.581	112
cluster_4.pdb ( medoid)	13.2733	10.0955	30.4644	134
cluster_5.pdb ( medoid)	10.3308	9.58297	20.7989	99
cluster_6.pdb ( medoid)	10.2999	9.22341	25.8544	95
cluster_7.pdb ( medoid)	7.67402	12.1188	33.3853	93
cluster_8.pdb ( medoid)	7.48627	11.3541	28.6199	85
cluster_9.pdb ( medoid)	7.44416	13.1647	32.0932	98
cluster_10.pdb ( medoid)	6.80009	11.7645	25.6127	80