Project name: PEP-81

Status: done

submitted: 2025-12-26 12:36:51, status changed: 2025-12-26 15:00:18

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence NTKNDKQM
Simulation mc cycles100
Peptide secondary structure psipred CCCCHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.0191 4.70028 20.0272 174
cluster_2.pdb ( medoid) 24.5128 5.09937 27.1788 125
cluster_3.pdb ( medoid) 17.2701 8.56974 34.3484 148
cluster_4.pdb ( medoid) 15.2581 7.20929 17.5655 110
cluster_5.pdb ( medoid) 12.8821 8.69421 33.1365 112
cluster_6.pdb ( medoid) 9.2686 8.09183 15.7042 75
cluster_7.pdb ( medoid) 8.2124 7.7931 20.897 64
cluster_8.pdb ( medoid) 6.63774 7.53269 21.7519 50
cluster_9.pdb ( medoid) 5.5524 18.0102 48.3273 100
cluster_10.pdb ( medoid) 4.00626 10.4836 27.0574 42