Project name: ecd42c9669b49d2

Status: done

submitted: 2026-04-10 15:24:42, status changed: 2026-04-10 19:52:13

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRVQPYGSNDARRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.1425 6.19604 33.4952 131
cluster_2.pdb ( medoid) 19.5064 3.48603 35.4517 68
cluster_3.pdb ( medoid) 14.8739 9.47968 42.0325 141
cluster_4.pdb ( medoid) 10.116 12.9498 35.7742 131
cluster_5.pdb ( medoid) 10.0375 13.3499 39.8477 134
cluster_6.pdb ( medoid) 9.12311 12.715 32.1301 116
cluster_7.pdb ( medoid) 7.23962 14.6417 33.5375 106
cluster_8.pdb ( medoid) 5.02114 12.547 35.1164 63
cluster_9.pdb ( medoid) 3.52821 15.8721 32.223 56
cluster_10.pdb ( medoid) 3.01545 17.9078 32.7315 54