CABS-dock: ece869d7dfb75ae

Project name: ece869d7dfb75ae

Status: done

submitted: 2026-07-08 15:58:54, status changed: 2026-07-08 18:03:09

Project settings

Protein sequence(s)	FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTNKQTSV input pdb
Peptide sequence	KQTSV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	61.9208	1.88951	16.302	117
cluster_2.pdb ( medoid)	32.0256	7.02563	30.2815	225
cluster_3.pdb ( medoid)	17.4318	9.80965	31.627	171
cluster_4.pdb ( medoid)	15.184	7.04687	27.4486	107
cluster_5.pdb ( medoid)	12.3661	6.63101	21.878	82
cluster_6.pdb ( medoid)	10.6555	8.5402	26.9119	91
cluster_7.pdb ( medoid)	9.97884	6.81442	26.1051	68
cluster_8.pdb ( medoid)	7.99857	6.87623	21.9366	55
cluster_9.pdb ( medoid)	5.96665	6.20114	21.0642	37
cluster_10.pdb ( medoid)	2.57796	18.2315	36.6594	47