Project name: ed5117171f0075d

Status: done

submitted: 2026-04-01 14:48:08, status changed: 2026-04-01 15:34:56

Project settings
Protein sequence(s) MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence IFLDSSPTTKAP
Simulation mc cycles5
Peptide secondary structure psipred CCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.6393 3.6037 14.7053 96
cluster_2.pdb ( medoid) 22.5418 4.87982 24.7189 110
cluster_3.pdb ( medoid) 17.4758 8.46886 28.502 148
cluster_4.pdb ( medoid) 17.0233 6.81417 29.7305 116
cluster_5.pdb ( medoid) 13.7011 9.70724 39.7473 133
cluster_6.pdb ( medoid) 13.6824 9.93977 24.1625 136
cluster_7.pdb ( medoid) 13.3616 4.49049 10.0295 60
cluster_8.pdb ( medoid) 7.58308 3.8243 6.45406 29
cluster_9.pdb ( medoid) 7.04338 15.4755 37.0802 109
cluster_10.pdb ( medoid) 2.90114 14.1324 34.5488 41