Project name: edf9f5afe5403c2

Status: done

submitted: 2024-07-26 06:30:37, status changed: 2024-07-26 08:24:35

Project settings
Protein sequence(s) ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVV input pdb
Peptide sequence LQVTDSGLYRCVIYHPP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.9251 2.71682 18.6087 65
cluster_2.pdb ( medoid) 16.8985 9.52746 26.4312 161
cluster_3.pdb ( medoid) 16.1528 9.65775 34.585 156
cluster_4.pdb ( medoid) 15.6976 2.42075 13.877 38
cluster_5.pdb ( medoid) 11.8879 8.15955 25.7158 97
cluster_6.pdb ( medoid) 10.9374 13.4401 30.3659 147
cluster_7.pdb ( medoid) 10.2883 10.9834 25.4591 113
cluster_8.pdb ( medoid) 9.11007 9.76941 23.6898 89
cluster_9.pdb ( medoid) 5.64621 12.3977 25.5117 70
cluster_10.pdb ( medoid) 5.12312 12.4924 23.7549 64