CABS-dock: EVTVTEDKI

Project name: EVTVTEDKI_ıl6

Status: done

submitted: 2025-03-09 19:15:43, status changed: 2025-03-09 22:49:32

Project settings

Protein sequence(s)	MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence	EVTVTEDKI
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.6185	4.33286	21.7802	124
cluster_2.pdb ( medoid)	22.0492	8.6171	22.7703	190
cluster_3.pdb ( medoid)	16.069	8.77466	24.3086	141
cluster_4.pdb ( medoid)	13.7408	10.5525	24.2808	145
cluster_5.pdb ( medoid)	8.27678	11.7195	26.221	97
cluster_6.pdb ( medoid)	8.27286	8.46141	23.561	70
cluster_7.pdb ( medoid)	7.93206	9.95958	28.9795	79
cluster_8.pdb ( medoid)	6.04514	9.26364	22.1431	56
cluster_9.pdb ( medoid)	4.42931	11.2885	23.7892	50
cluster_10.pdb ( medoid)	4.33375	11.0759	19.9755	48