Project name: lily

Status: done

submitted: 2026-07-22 23:55:18, status changed: 2026-07-23 06:24:19

Project settings
Protein sequence(s) PPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCQGTTESDVV input pdb
Peptide sequence NVLKLASGE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.9552 6.55391 17.1942 157
cluster_2.pdb ( medoid) 19.4021 7.47341 31.5375 145
cluster_3.pdb ( medoid) 19.1542 4.85532 17.7496 93
cluster_4.pdb ( medoid) 18.5079 6.48372 24.9413 120
cluster_5.pdb ( medoid) 18.3195 4.42153 18.074 81
cluster_6.pdb ( medoid) 12.4543 13.8105 39.5602 172
cluster_7.pdb ( medoid) 9.42341 8.59561 20.0162 81
cluster_8.pdb ( medoid) 8.49282 7.53578 18.7603 64
cluster_9.pdb ( medoid) 6.88969 4.78976 13.3461 33
cluster_10.pdb ( medoid) 4.78803 11.2781 21.5008 54