Project name: eea9e53c242327b

Status: done

submitted: 2026-03-19 10:57:43, status changed: 2026-03-19 13:17:14

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence KRLVQVFGSNTYRLK
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.3365 5.21231 15.3691 106
cluster_2.pdb ( medoid) 19.9397 4.96498 15.8934 99
cluster_3.pdb ( medoid) 18.8119 5.15632 11.8198 97
cluster_4.pdb ( medoid) 18.4193 8.08934 22.1227 149
cluster_5.pdb ( medoid) 18.1529 5.61895 18.7752 102
cluster_6.pdb ( medoid) 13.9503 8.9604 23.2737 125
cluster_7.pdb ( medoid) 12.407 10.5585 21.0918 131
cluster_8.pdb ( medoid) 9.37817 8.74371 20.7442 82
cluster_9.pdb ( medoid) 7.48064 5.6145 12.9848 42
cluster_10.pdb ( medoid) 7.21694 9.28371 16.931 67