CABS-dock: efa9c923031f053

Project name: efa9c923031f053

Status: done

submitted: 2026-06-03 15:49:36, status changed: 2026-06-03 17:32:02

Project settings

Protein sequence(s)	ASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKEC input pdb
Peptide sequence	MNAQRTLEKP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.1582	3.34901	7.71228	101
cluster_2.pdb ( medoid)	28.8805	3.94731	24.7762	114
cluster_3.pdb ( medoid)	25.1525	4.05526	32.9233	102
cluster_4.pdb ( medoid)	16.2418	12.3754	24.3752	201
cluster_5.pdb ( medoid)	16.1767	3.8945	14.1592	63
cluster_6.pdb ( medoid)	14.3808	9.52662	26.4764	137
cluster_7.pdb ( medoid)	14.3398	6.41573	15.7743	92
cluster_8.pdb ( medoid)	14.0976	3.75952	14.284	53
cluster_9.pdb ( medoid)	10.7371	7.07825	17.8192	76
cluster_10.pdb ( medoid)	3.68693	16.5449	33.989	61