Project name: f0edd93b7f7d6f2

Status: done

submitted: 2025-12-29 07:05:45, status changed: 2025-12-30 06:43:51

Project settings
Protein sequence(s) PVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYCPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYC input pdb
Peptide sequence NPKVAHCASQ
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.7331 5.84691 34.0424 168
cluster_2.pdb ( medoid) 27.657 4.15808 13.388 115
cluster_3.pdb ( medoid) 18.6919 6.2059 42.4732 116
cluster_4.pdb ( medoid) 17.7101 4.06547 7.39839 72
cluster_5.pdb ( medoid) 14.287 9.58917 27.2671 137
cluster_6.pdb ( medoid) 10.5642 14.7669 54.4124 156
cluster_7.pdb ( medoid) 4.89748 15.5182 42.7049 76
cluster_8.pdb ( medoid) 4.87255 14.5714 41.2075 71
cluster_9.pdb ( medoid) 2.80824 12.8194 34.8308 36
cluster_10.pdb ( medoid) 2.77453 19.1023 44.388 53