CABS-dock: 7T5M_HKSAIV

Project name: 7T5M_HKSAIV_E2

Status: done

submitted: 2026-05-30 16:13:11, status changed: 2026-05-31 14:50:54

Project settings

Protein sequence(s)	GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence	HKSAIVTLTYDSEWQRDQ
Simulation mc cycles	200
Peptide secondary structure psipred	CCCEEEEEECCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	61.7132	2.0255	11.3586	125
cluster_2.pdb ( medoid)	40.1281	4.61024	13.6274	185
cluster_3.pdb ( medoid)	26.7329	5.16219	16.3478	138
cluster_4.pdb ( medoid)	25.2073	3.2927	6.08852	83
cluster_5.pdb ( medoid)	20.8212	2.16126	14.3721	45
cluster_6.pdb ( medoid)	15.6641	8.49073	20.6101	133
cluster_7.pdb ( medoid)	15.3092	7.44652	33.2426	114
cluster_8.pdb ( medoid)	13.2962	2.78275	10.6308	37
cluster_9.pdb ( medoid)	12.362	2.10322	11.3012	26
cluster_10.pdb ( medoid)	7.20615	15.8198	32.2058	114