Project name: f1c432d4d539d6a

Status: done

submitted: 2026-03-12 14:59:27, status changed: 2026-03-12 18:35:10

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RKWVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCEECCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 22.5288 6.0811 25.81 137
cluster_2.pdb ( medoid) 21.9642 5.2358 23.2283 115
cluster_3.pdb ( medoid) 11.1356 10.0578 25.3396 112
cluster_4.pdb ( medoid) 10.9816 13.2038 29.5921 145
cluster_5.pdb ( medoid) 9.4369 8.05349 28.6199 76
cluster_6.pdb ( medoid) 7.42092 14.6882 34.9853 109
cluster_7.pdb ( medoid) 7.04681 12.0622 23.499 85
cluster_8.pdb ( medoid) 6.57705 13.684 29.0889 90
cluster_9.pdb ( medoid) 6.38631 11.5873 30.2015 74
cluster_10.pdb ( medoid) 4.13922 13.7707 29.2881 57