Project name: PEP1

Status: done

submitted: 2026-04-10 05:36:10, status changed: 2026-04-10 10:08:41

Project settings
Protein sequence(s) GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL input pdb
Peptide sequence NLKSHESPERHEN
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCC
Flexible regions
61:A - 95:A
Contact information
61-95
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.3328 6.95889 36.1142 225
cluster_2.pdb ( medoid) 22.5509 5.05523 38.0675 114
cluster_3.pdb ( medoid) 16.0585 8.90493 23.9427 143
cluster_4.pdb ( medoid) 14.639 7.24095 16.2478 106
cluster_5.pdb ( medoid) 10.975 7.38039 22.5301 81
cluster_6.pdb ( medoid) 9.60336 8.9552 20.9366 86
cluster_7.pdb ( medoid) 7.52272 9.571 24.4114 72
cluster_8.pdb ( medoid) 5.12345 9.95423 32.2745 51
cluster_9.pdb ( medoid) 4.85214 11.5413 27.6981 56
cluster_10.pdb ( medoid) 4.05603 16.2721 42.5073 66