Project name: 2LAS

Status: done

submitted: 2026-03-19 19:49:38, status changed: 2026-03-19 21:33:21

Project settings
Protein sequence(s) EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG input pdb
Peptide sequence DNEIEVIIVWEKK
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.5608 2.13087 13.4652 112
cluster_2.pdb ( medoid) 28.0253 4.28185 12.8163 120
cluster_3.pdb ( medoid) 26.684 3.37281 7.91487 90
cluster_4.pdb ( medoid) 24.4428 4.58213 11.7717 112
cluster_5.pdb ( medoid) 18.1833 5.00459 14.7944 91
cluster_6.pdb ( medoid) 16.4767 7.52579 22.3925 124
cluster_7.pdb ( medoid) 11.9923 10.2566 26.2905 123
cluster_8.pdb ( medoid) 11.0062 5.90578 13.9021 65
cluster_9.pdb ( medoid) 8.58254 11.4185 29.1041 98
cluster_10.pdb ( medoid) 6.51313 9.97984 25.3466 65