Project name: subunit_1-15_alkv

Status: done

submitted: 2025-11-13 10:21:21, status changed: 2025-11-13 23:13:41

Project settings
Protein sequence(s) DMGCAIDANRMELRCGEGLVVWREVTDWYDGYAFHPESPPVLAASLKEAYEEGVCGIVPQNRLEMAMWRRVEAVLNLALAESDANLTVVVDRRDPSDYRGGKVGILKRSGKEMKTSWKGWSQSFVWSVPESPRRFMVGIEGTGECPLDKRRTGVFTVAEFGMGMRTKIFLDLRETSSSDCDTGVMGAAVKSGHAVHTDQSLWMKSHRNATGVFISELIVTDLRNCTWPASHTLDNAGVVDSKLFLPVSLAGPRSHYNHIPGYAEQVRGPWNQTPLRVVREPCPGTTVKIDQNCDKRGSSLRSTTESGKAIPEWCCRTCELPPVTFRSGTDCWYAMEIRPVHQQGGLVRSMVLA input pdb
Peptide sequence DMGCAIDANRMELRC
Simulation mc cycles50
Peptide secondary structure psipred CCCCEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.3693 4.53303 12.8395 115
cluster_2.pdb ( medoid) 20.3712 5.89067 23.1423 120
cluster_3.pdb ( medoid) 17.8607 4.14317 18.5256 74
cluster_4.pdb ( medoid) 16.124 9.42697 22.049 152
cluster_5.pdb ( medoid) 15.9728 3.25554 25.7998 52
cluster_6.pdb ( medoid) 14.6527 9.3498 29.8307 137
cluster_7.pdb ( medoid) 13.8234 4.05109 16.7793 56
cluster_8.pdb ( medoid) 5.97149 18.2534 52.2155 109
cluster_9.pdb ( medoid) 4.17851 12.6839 37.238 53
cluster_10.pdb ( medoid) 1.95989 16.3275 43.9354 32