CABS-dock: f41eb0d22a77b71

Project name: f41eb0d22a77b71

Status: done

submitted: 2026-03-09 05:01:14, status changed: 2026-03-09 07:33:05

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGDNAY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.9466	4.40784	27.181	132
cluster_2.pdb ( medoid)	16.0285	7.7362	43.5011	124
cluster_3.pdb ( medoid)	14.2984	8.3226	37.3297	119
cluster_4.pdb ( medoid)	10.9413	12.43	27.6811	136
cluster_5.pdb ( medoid)	9.92493	8.76581	20.1593	87
cluster_6.pdb ( medoid)	9.7944	10.1078	29.1912	99
cluster_7.pdb ( medoid)	9.02738	9.30503	19.5553	84
cluster_8.pdb ( medoid)	7.75286	9.15792	27.8009	71
cluster_9.pdb ( medoid)	5.76621	13.8739	32.1273	80
cluster_10.pdb ( medoid)	4.49167	15.1391	33.7036	68