CABS-dock: f52965b945cdcdd

Project name: f52965b945cdcdd

Status: done

submitted: 2026-07-22 04:24:15, status changed: 2026-07-22 06:45:25

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRVIVQVQCGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	15.9356	9.72662	38.284	155
cluster_2.pdb ( medoid)	14.1766	7.6182	31.4677	108
cluster_3.pdb ( medoid)	13.92	9.77015	47.0292	136
cluster_4.pdb ( medoid)	7.58778	14.7606	43.1643	112
cluster_5.pdb ( medoid)	7.48576	17.4999	45.7245	131
cluster_6.pdb ( medoid)	6.60547	14.6848	32.485	97
cluster_7.pdb ( medoid)	6.36095	11.4763	24.9306	73
cluster_8.pdb ( medoid)	5.82671	10.2974	21.5243	60
cluster_9.pdb ( medoid)	5.7709	12.823	37.7609	74
cluster_10.pdb ( medoid)	3.90007	13.8459	47.0554	54