Project name: 1539

Status: done

submitted: 2026-04-20 16:41:17, status changed: 2026-04-20 23:32:36

Project settings
Protein sequence(s) MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP input pdb
Peptide sequence KKRKRRFLGFLLAVNSA
Simulation mc cycles50
Peptide secondary structure psipred CCCHHHHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.8163 4.87061 22.5931 116
cluster_2.pdb ( medoid) 23.1409 4.49421 39.1064 104
cluster_3.pdb ( medoid) 16.6842 8.39118 43.3483 140
cluster_4.pdb ( medoid) 13.4899 7.56119 22.2187 102
cluster_5.pdb ( medoid) 9.35871 9.93727 22.3998 93
cluster_6.pdb ( medoid) 8.18439 10.5078 22.2164 86
cluster_7.pdb ( medoid) 6.62823 13.5783 27.4534 90
cluster_8.pdb ( medoid) 6.54722 6.41493 17.1635 42
cluster_9.pdb ( medoid) 6.46169 10.3688 29.5846 67
cluster_10.pdb ( medoid) 3.57057 17.9243 41.8635 64