Project name: f65c735e50f22d6

Status: done

submitted: 2026-01-16 10:00:06, status changed: 2026-01-16 13:21:28

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence RVIVQVGFSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.0302 7.56056 27.4735 159
cluster_2.pdb ( medoid) 17.94 7.97102 36.4021 143
cluster_3.pdb ( medoid) 12.916 10.2973 25.0558 133
cluster_4.pdb ( medoid) 9.4164 10.8322 27.6762 102
cluster_5.pdb ( medoid) 9.23969 8.33361 28.0125 77
cluster_6.pdb ( medoid) 8.46027 11.5836 28.1887 98
cluster_7.pdb ( medoid) 8.18603 11.1165 30.4542 91
cluster_8.pdb ( medoid) 6.7705 10.6344 32.9605 72
cluster_9.pdb ( medoid) 5.86118 13.4785 35.8975 79
cluster_10.pdb ( medoid) 3.27149 14.0609 28.7407 46