CABS-dock: F144A

Project name: F144A

Status: done

submitted: 2026-01-14 15:02:57, status changed: 2026-01-14 21:41:57

Project settings

Protein sequence(s)	SLSTIICIGMAGSGKTTFMQRLNSHLRAEKTPPYVINLDPAVLRVPYGANIDIRDSIKYKKVGPNGAIVTSLNLFSTKIDQVIRLVEQKKDKFQNCIIDTPGQIECFVWSASGAIITESFASSFPTVIAYIVDTPRNSSPTTAMSNMLYACSILYKTKLPMIVVFNKTDVCKADFAKEWMTDFESFQAAIKEDQDGYMSSLVNSMSLMLEEFYSQLDVVGVSSFTGDGFDEFMQCVDKKVDEYDQYYKKHHHH input pdb
Peptide sequence	KNTMQYLTNFSRFRD
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHCHHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	80.817	1.27448	17.4068	103
cluster_2.pdb ( medoid)	35.4919	2.78937	9.66519	99
cluster_3.pdb ( medoid)	28.5367	2.66324	10.919	76
cluster_4.pdb ( medoid)	27.0318	7.13973	31.3072	193
cluster_5.pdb ( medoid)	26.0322	3.99505	16.7678	104
cluster_6.pdb ( medoid)	18.0415	10.8084	38.4049	195
cluster_7.pdb ( medoid)	13.5327	8.57186	26.2418	116
cluster_8.pdb ( medoid)	10.703	3.36356	10.6856	36
cluster_9.pdb ( medoid)	10.5462	4.5514	24.3102	48
cluster_10.pdb ( medoid)	1.82272	16.4589	34.4099	30