CABS-dock: f7c3956d3cb9126

Project name: f7c3956d3cb9126

Status: done

submitted: 2026-02-19 02:25:11, status changed: 2026-02-19 07:20:13

Project settings

Protein sequence(s)	SEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDFQSKPNVHVDGYFERLAKLELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDFQSKPNVHVDGYFERLAKL input pdb
Peptide sequence	LENKLEALKKILEYLEE
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	39.8537	2.4339	7.40843	97
cluster_2.pdb ( medoid)	38.7351	2.63327	20.0653	102
cluster_3.pdb ( medoid)	29.9148	9.52706	22.1369	285
cluster_4.pdb ( medoid)	23.9074	5.31217	25.3365	127
cluster_5.pdb ( medoid)	18.8378	7.69729	23.9199	145
cluster_6.pdb ( medoid)	9.33535	7.92686	20.5536	74
cluster_7.pdb ( medoid)	6.74092	12.1645	23.825	82
cluster_8.pdb ( medoid)	4.15282	11.5584	25.6991	48
cluster_9.pdb ( medoid)	2.10522	9.97518	16.8899	21
cluster_10.pdb ( medoid)	1.40761	13.4981	24.3443	19