Project name: G3BP-TMP22

Status: done

submitted: 2026-04-20 13:06:54, status changed: 2026-04-20 19:39:10

Project settings
Protein sequence(s) SMVMEKPSPLLVGREWVRQYYTLLNQAPDMLHRWYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKWYVHNDIFRYQDEVFMVMEKPSPLLVGREWVRQYYTLLNQAPDMLHRWYGKNSSYVHGGLDSPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPWYVHNDIFRYQDEVF input pdb
Peptide sequence GRKKRRQRRRRGGVDKDRVKQMK
Simulation mc cycles50
Peptide secondary structure psipred CCHHHHHHHHCCCCCHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.8101 6.59384 26.3881 157
cluster_2.pdb ( medoid) 22.5032 4.62155 18.8384 104
cluster_3.pdb ( medoid) 12.5372 4.14766 27.6881 52
cluster_4.pdb ( medoid) 12.0085 13.9068 29.3366 167
cluster_5.pdb ( medoid) 10.8688 11.8688 39.208 129
cluster_6.pdb ( medoid) 8.69699 11.4982 33.2892 100
cluster_7.pdb ( medoid) 7.39528 10.5473 37.176 78
cluster_8.pdb ( medoid) 7.18369 9.18748 31.0522 66
cluster_9.pdb ( medoid) 6.10457 15.8897 42.3634 97
cluster_10.pdb ( medoid) 3.61203 13.8426 39.6338 50