CABS-dock: f88ddd83efa25b1

Project name: f88ddd83efa25b1

Status: done

submitted: 2026-07-22 09:05:32, status changed: 2026-07-22 11:11:38

Project settings

Protein sequence(s)	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA input pdb
Peptide sequence	TTDHISAAGPW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.446	6.93919	23.2962	128
cluster_2.pdb ( medoid)	18.3484	8.39308	36.5691	154
cluster_3.pdb ( medoid)	16.0286	7.36184	22.3756	118
cluster_4.pdb ( medoid)	15.2303	9.19221	34.1798	140
cluster_5.pdb ( medoid)	15.0712	8.95747	34.6862	135
cluster_6.pdb ( medoid)	9.38495	12.0405	27.6271	113
cluster_7.pdb ( medoid)	5.97906	11.373	21.8188	68
cluster_8.pdb ( medoid)	4.90392	11.2155	22.5312	55
cluster_9.pdb ( medoid)	3.94456	14.7038	33.6257	58
cluster_10.pdb ( medoid)	2.19082	14.15	30.2257	31