CABS-dock: f8960786cfa59ea

Project name: f8960786cfa59ea

Status: done

submitted: 2026-03-15 16:21:42, status changed: 2026-03-15 19:19:15

Project settings

Protein sequence(s)	MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI input pdb
Peptide sequence	TRYPLIFSRVKKSVEVLKNNK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHHHHHHHHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.4301	4.25704	21.9314	104
cluster_2.pdb ( medoid)	22.631	4.55127	19.463	103
cluster_3.pdb ( medoid)	21.1323	7.94992	24.3638	168
cluster_4.pdb ( medoid)	16.4792	6.9178	21.5682	114
cluster_5.pdb ( medoid)	11.7604	7.73782	19.0077	91
cluster_6.pdb ( medoid)	11.4176	6.91917	16.5021	79
cluster_7.pdb ( medoid)	10.9451	11.6033	33.0063	127
cluster_8.pdb ( medoid)	8.64425	11.2213	27.5701	97
cluster_9.pdb ( medoid)	6.99994	4.57147	12.1892	32
cluster_10.pdb ( medoid)	6.52657	13.0237	38.0255	85