Warning: Something went wrong. In most cases your PDB file is not properly formatted (according to the PDB file format):
  • continuous residue numbering (breaks are allowed, but chain must be numbered from N to M, where N<M)
  • proper atom names within residues (for example if PDB file contains MET residue - atoms must be as in the methionine)
  • residue numbering must be unique - you cannot upload structure with the same residue index within the same chain
  • each chain must be defined with unique chain index. Empty string (" ") in chain index column is chain index, too. If you uploaded multichain structure without chain index column - you'll get an error
  • If PDB file looks good, do not hesistate to contact us (email in Contact tab), we will check logs of your job.

Project name: PEP_3VMN

Status: error

submitted: 2026-04-06 13:51:09, status changed: 2026-04-06 13:56:09

Project settings
Protein sequence(s) NGNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE input pdb
Peptide sequence TQANFNTLRSLGVKGAVVKA
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHCCCCCEEEEC
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue