Project name: braf_monomer_peptide_7

Status: done

submitted: 2025-12-28 10:30:21, status changed: 2025-12-28 17:27:01

Project settings
Protein sequence(s) DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYKHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRRDLKSNNIFLHEDNNTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAEECLKKKRDERPSFPRILAEIEELARE input pdb
Peptide sequence KTRHVNILLFM
Simulation mc cycles50
Peptide secondary structure psipred CCCEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.6152 6.1455 25.0355 182
cluster_2.pdb ( medoid) 28.3984 2.9227 7.72531 83
cluster_3.pdb ( medoid) 27.8087 5.82552 26.9867 162
cluster_4.pdb ( medoid) 16.4327 9.61498 37.9305 158
cluster_5.pdb ( medoid) 13.5278 6.43121 19.2985 87
cluster_6.pdb ( medoid) 6.95533 5.60721 29.6553 39
cluster_7.pdb ( medoid) 6.80342 9.40704 23.9896 64
cluster_8.pdb ( medoid) 6.38167 6.89474 24.9217 44
cluster_9.pdb ( medoid) 6.04302 17.3754 42.4554 105
cluster_10.pdb ( medoid) 5.76734 13.1776 32.5714 76