CABS-dock: f9605e529759d80

Project name: f9605e529759d80

Status: done

submitted: 2025-12-23 15:34:22, status changed: 2025-12-24 02:43:57

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIFVQCGSNCFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	41.7559	2.68226	20.0823	112
cluster_2.pdb ( medoid)	18.0542	7.53287	35.6367	136
cluster_3.pdb ( medoid)	17.4868	8.63506	30.5627	151
cluster_4.pdb ( medoid)	17.2546	6.83877	38.1588	118
cluster_5.pdb ( medoid)	14.6515	9.14583	39.297	134
cluster_6.pdb ( medoid)	7.06387	11.8915	32.5677	84
cluster_7.pdb ( medoid)	6.06439	9.56403	32.9724	58
cluster_8.pdb ( medoid)	4.7672	16.152	36.1457	77
cluster_9.pdb ( medoid)	4.67126	14.343	28.7882	67
cluster_10.pdb ( medoid)	4.28969	14.6864	40.5113	63