CABS-dock: f9eb191c44bfd83

Project name: f9eb191c44bfd83

Status: done

submitted: 2026-03-08 14:18:27, status changed: 2026-03-08 17:06:00

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGLNNY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.6899	4.00838	19.7827	115
cluster_2.pdb ( medoid)	23.7424	5.60179	24.5279	133
cluster_3.pdb ( medoid)	21.7887	8.44476	29.381	184
cluster_4.pdb ( medoid)	17.2915	7.74946	20.3796	134
cluster_5.pdb ( medoid)	9.96628	10.3348	23.0864	103
cluster_6.pdb ( medoid)	8.17714	10.6394	24.2826	87
cluster_7.pdb ( medoid)	6.51228	11.6703	22.0674	76
cluster_8.pdb ( medoid)	6.48436	12.029	27.4867	78
cluster_9.pdb ( medoid)	4.53483	12.7899	36.3349	58
cluster_10.pdb ( medoid)	2.6046	12.2859	24.1784	32