CABS-dock: fa6875ce5906fd4

Project name: fa6875ce5906fd4

Status: done

submitted: 2025-04-22 12:20:58, status changed: 2025-04-22 15:57:35

Project settings

Protein sequence(s)	QPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK input pdb
Peptide sequence	YNRSTSSTIYDSMGQ
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	51.7866	2.00824	20.0257	104
cluster_2.pdb ( medoid)	23.7629	5.7653	17.5464	137
cluster_3.pdb ( medoid)	20.282	8.28323	32.9868	168
cluster_4.pdb ( medoid)	15.6784	5.35768	15.1247	84
cluster_5.pdb ( medoid)	14.0191	7.98909	38.3196	112
cluster_6.pdb ( medoid)	12.4187	6.11979	22.2232	76
cluster_7.pdb ( medoid)	10.2519	9.65673	28.5371	99
cluster_8.pdb ( medoid)	9.53193	11.3303	36.1946	108
cluster_9.pdb ( medoid)	7.68819	8.19439	18.6197	63
cluster_10.pdb ( medoid)	3.19497	15.3366	31.2466	49