CABS-dock: fabfe2f5b034472

Project name: fabfe2f5b034472

Status: done

submitted: 2026-04-09 10:47:16, status changed: 2026-04-09 15:33:39

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQLFPGSNDARRRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.1863	9.23773	28.9511	168
cluster_2.pdb ( medoid)	18.0433	7.64825	32.0921	138
cluster_3.pdb ( medoid)	16.2307	8.74886	37.1794	142
cluster_4.pdb ( medoid)	10.9512	11.7795	30.1255	129
cluster_5.pdb ( medoid)	6.73151	13.6671	26.3995	92
cluster_6.pdb ( medoid)	5.51988	15.3989	48.0268	85
cluster_7.pdb ( medoid)	5.51809	14.679	31.8218	81
cluster_8.pdb ( medoid)	4.57122	13.5631	41.7024	62
cluster_9.pdb ( medoid)	4.03755	14.8605	29.1353	60
cluster_10.pdb ( medoid)	2.25708	19.0511	45.0072	43