Project name: 9ASF_AIYYKA_E2

Status: done

submitted: 2026-05-30 16:22:45, status changed: 2026-05-31 10:30:29

Project settings
Protein sequence(s) GSSHSMRYFFTSVSRPGRGEPRFIAVVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSSQQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW input pdb
Peptide sequence AIYYKAREMGFKHINHQVVPTL
Simulation mc cycles200
Peptide secondary structure psipred CCCHHHHHHCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 48.4009 1.38427 9.87247 67
cluster_2.pdb ( medoid) 42.9716 2.51329 7.05256 108
cluster_3.pdb ( medoid) 37.8705 2.69339 5.93631 102
cluster_4.pdb ( medoid) 20.4146 7.54361 31.5135 154
cluster_5.pdb ( medoid) 17.664 3.90625 14.3075 69
cluster_6.pdb ( medoid) 16.545 7.19249 18.7414 119
cluster_7.pdb ( medoid) 14.6409 3.6883 13.1595 54
cluster_8.pdb ( medoid) 11.9722 10.5244 26.1904 126
cluster_9.pdb ( medoid) 11.3044 10.35 23.6829 117
cluster_10.pdb ( medoid) 9.11868 9.21186 21.3466 84