CABS-dock: flexiblelinker

Project name: flexiblelinker

Status: done

submitted: 2026-01-23 12:20:23, status changed: 2026-01-23 15:07:37

Project settings

Protein sequence(s)	KRRIRRERNKMAAAKSRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILARKRMRNRIAASKSRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVM input pdb
Peptide sequence	SKWQHQQDSCGGGGSPKKKRKV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.2632	5.21643	20.3203	137
cluster_2.pdb ( medoid)	23.1657	8.93562	24.0906	207
cluster_3.pdb ( medoid)	18.6714	6.8554	19.833	128
cluster_4.pdb ( medoid)	12.1655	11.6723	28.9295	142
cluster_5.pdb ( medoid)	6.84419	9.64322	22.6447	66
cluster_6.pdb ( medoid)	6.48037	11.7277	26.9724	76
cluster_7.pdb ( medoid)	5.82352	11.5051	26.9066	67
cluster_8.pdb ( medoid)	5.5879	9.12687	22.1698	51
cluster_9.pdb ( medoid)	5.46782	9.87597	19.0149	54
cluster_10.pdb ( medoid)	4.68285	15.3753	32.9936	72